DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG3505

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:363 Identity:101/363 - (27%)
Similarity:153/363 - (42%) Gaps:76/363 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GR-SGYCILAYQCLHVIREYRVHGT---------RIDICTHRNNVPVICCPLADKHVLAQRISAT 153
            || :|:||...:|.:.:| ..:.|.         |.:.|..|.|...:|||              
  Fly    34 GRVTGHCISIRECDYFMR-ILLSGNLSQSDRNLLRDNQCGVRGNDVQVCCP-------------- 83

  Fly   154 KCQEYNAAARRLHLTDTGRTFSGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKW 218
            ......|....|..:|.|:....:.         ..|.||...||.:|.:.:|:|:..|..    
  Fly    84 STAGLGALTHPLLPSDCGKVRWQRS---------NDTDTRIREFPWLALIEYTRGNQEKIH---- 135

  Fly   219 GCGGALVSELYVLTAAHC---ATSGSKPPDMVRLGA--------RQLNETSAT------QQDIKI 266
            .|||.|:|:.||||||||   |.:.:.....||||.        .|.:|.|..      .|||.|
  Fly   136 ACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAI 200

  Fly   267 LIIVLHPKYRSS--AYYHDIALLKLTRRVKFSEQVRPACL----WQLPELQIPTVVAAGWGRTEF 325
            ..::.||.|..:  ...:||||::|....|.::.|:|.||    .:..||:......|||     
  Fly   201 EELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGW----- 260

  Fly   326 LGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLP 390
            ..:.|..:|:..:.:.....|::.|..::   ..|...:.|.  |...:: |.|::|||   |:.
  Fly   261 QASSSQRMRKGYVTISSIEECQRKYASQQ---LRIQASKLCG--LTNSQE-CYGNAGGP---LML 316

  Fly   391 EYNCVAFVVGITSFGKF-CAAPNAPGVYTRLYSYLDWI 427
            ..|....:.|:.|||.. |..|:.|.||||:.||:|||
  Fly   317 FKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829 13/49 (27%)
Tryp_SPc 186..430 CDD:238113 82/266 (31%)
Tryp_SPc 186..427 CDD:214473 80/264 (30%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 12/48 (25%)
Tryp_SPc 111..356 CDD:238113 82/262 (31%)
Tryp_SPc 111..354 CDD:214473 80/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.