DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG31326

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:268 Identity:66/268 - (24%)
Similarity:117/268 - (43%) Gaps:29/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSG 240
            |::...:.|||..|...:.|..|.:.|:...:.|...    .:.|||.|:|...||:||||..:.
  Fly   264 GRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGP----AFICGGTLISTSTVLSAAHCFRAP 324

  Fly   241 SKPPDMVRLGARQLNETSATQQDIK---ILIIVLHPKYRSSAYYH-DIALLKLTRRVKFSEQVRP 301
            .:.....||.......|.|...|.:   :..:::|..::...:.. |:||::|...|::::.:.|
  Fly   325 GRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVP 389

  Fly   302 ACLWQLP-ELQIPTVV---AAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIE 362
            .|||... .:.:|..:   .||||..|.....:...:..||::|.:..|      ...||..:::
  Fly   390 ICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANC------ALELPHVLVQ 448

  Fly   363 -GQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNA-----PGVYTRLY 421
             ...||  ...|...|..|.|||:  :|.|.: |..:.|:.|.|......|.     |.|:|.:.
  Fly   449 PSSLCA--KKTGAGPCASDGGGPL--MLREQD-VWVLRGVISGGVINEKENTCELSKPSVFTDVA 508

  Fly   422 SYLDWIEK 429
            .:::|:.:
  Fly   509 KHIEWVRQ 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 63/258 (24%)
Tryp_SPc 186..427 CDD:214473 62/254 (24%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 62/255 (24%)
Tryp_SPc 277..514 CDD:214473 61/251 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.