DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG9649

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:303 Identity:83/303 - (27%)
Similarity:136/303 - (44%) Gaps:49/303 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 EYNAAAR-RLHLTDTGRTFS--------------GKQCVPSVPLIVGGTPTRHGLFPHMAALGWT 206
            |:..:|| .:|.::|....|              |::.|...|.|..|.....|..|.||||...
  Fly   213 EFQTSARPSVHPSNTPAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEH 277

  Fly   207 QGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSK--PPD--MVRLGARQLN--ETSATQQDIK 265
            .|     :|..:.|||.|:|...|::||||...||:  |.:  :|.||...|:  .:.||   :.
  Fly   278 VG-----RDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGAT---LG 334

  Fly   266 ILIIVLHPKYRSSAYYH-DIALLKLTRRVKFSEQVRPACLWQLPE---LQIPT---VVAAGWGRT 323
            :..:::|.:|..:.|.. |:|||:|:..|...:.::|.|||.  |   |::|:   ...||||..
  Fly   335 VARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWN--ENFLLELPSGHKSYVAGWGED 397

  Fly   324 EFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHAL 388
            |.....:...:..|.|::.|..|:....:|.  .:.|.....||...... ..|.|||||.:  :
  Fly   398 EKGNRNTRLAKMTDTDIITQWECRGNLSEEN--AKFITSHTICASNAQAS-GPCSGDSGGGL--M 457

  Fly   389 LPEYNCVAFVVGITSFGK----FCAAPNAPGVYTRLYSYLDWI 427
            |.|.: :..:.|:.|.|:    .|.. ..|.:||.:..:::|:
  Fly   458 LQEQD-IWMLRGVVSAGQRMTNRCNL-TLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 74/259 (29%)
Tryp_SPc 186..427 CDD:214473 73/257 (28%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 73/257 (28%)
Tryp_SPc 259..497 CDD:214473 72/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.