DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG8870

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:327 Identity:87/327 - (26%)
Similarity:139/327 - (42%) Gaps:69/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ISATKCQEYNAA--ARRLHLTDTGRTFSGKQCVPS----VPLIVGG----TPTRHGL-----FPH 199
            ::..||....|.  :.|.::....|..:.|.|.|.    :|....|    .||:..:     ||.
  Fly    33 VNLDKCPRTRAVMNSSRKNIIGLRRCGTNKVCCPKWETYLPHDTCGQSRRKPTKGKIPALNEFPW 97

  Fly   200 MAALGWTQGSGSKD---QDIKWGCGGALVSELYVLTAAHCAT------------------SGSKP 243
            ||.|.:    |:|:   |.:...|||:|::..||||||||..                  :.|..
  Fly    98 MAMLLY----GNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTN 158

  Fly   244 PDMVRLGARQLNETSATQQDIKILIIVLHPKY-RSSAYYHDIALLKLTRRVKFSEQVRPACLWQL 307
            ||...:..|:  :.:....:|::..|:.|.:: |.....:||||::|...|:::..::|.||.:.
  Fly   159 PDRAIVNGRR--QYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRA 221

  Fly   308 PELQI--PTVVAAGW---GR---TEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQ 364
            .:|..  ....|:||   |:   :|.|.....|.|..|:       ||..|...       :..|
  Fly   222 QKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDV-------CKSNYDFN-------LGSQ 272

  Fly   365 FCAGYLPGGRDTCQGDSGGPI-HALLPEYNCVAFVVGITSFG-KFCAAPNA-PGVYTRLYSYLDW 426
            .|||.| .|.||..||||||: ..::.....:.:..||.|:| |.|..... |..||:...:.:|
  Fly   273 ICAGGL-DGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEW 336

  Fly   427 IE 428
            |:
  Fly   337 IK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 78/285 (27%)
Tryp_SPc 186..427 CDD:214473 76/282 (27%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 75/267 (28%)
Tryp_SPc 93..337 CDD:214473 73/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.