DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG14642

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster


Alignment Length:290 Identity:111/290 - (38%)
Similarity:147/290 - (50%) Gaps:38/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 QEYNAAARRLHLTDTG-------RTFSGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKD 213
            |:|:....|:...||.       ..|.|:            ...|.|.:|||||:|:....|..|
  Fly   119 QKYSEYVERIFPNDTAVAADANDADFDGR------------VLARPGEYPHMAAVGFESDRGQVD 171

  Fly   214 QDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLGARQL--NETSATQQDIKILIIVLHPKYR 276
                :.|||:|:||.:|||||||.:....||..||:|...|  .:.|...|.::|..:..||.|:
  Fly   172 ----YKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYK 232

  Fly   277 SSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVV 341
            ...||.|||||||.:.|:.:|.|||..||..|||......|.|:|.|.|....:|.|..::|.||
  Fly   233 KKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVV 297

  Fly   342 PQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLP--------EYNCVAFV 398
            |...|..........|.|::|.|.||......|||||||||||:...||        .|:    :
  Fly   298 PNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYH----L 358

  Fly   399 VGITSFGKFCAAPNAPGVYTRLYSYLDWIE 428
            :||||:|.||.: :.|.||||:.|:|||||
  Fly   359 IGITSYGVFCRS-SYPSVYTRVSSFLDWIE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 104/253 (41%)
Tryp_SPc 186..427 CDD:214473 101/250 (40%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 103/261 (39%)
Tryp_SPc 146..386 CDD:214473 102/260 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012732
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.910

Return to query results.
Submit another query.