DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG18223

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:230 Identity:55/230 - (23%)
Similarity:102/230 - (44%) Gaps:44/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 CGGALVSELYVLTAAHCATSGSKPPDMVRL------GARQLNETSATQQDIKILIIVLHPKYRSS 278
            |||.::|..|:||:||||....|.....|:      ...:|........::::..|.:..|: :.
  Fly    79 CGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKF-TV 142

  Fly   279 AYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPTV--------VAAGWGRTEFLGAKSNALRQ 335
            ...::|||:.|.:::.....:       :..:.:||.        ...||||....|..::.:..
  Fly   143 FNTNNIALMMLAKKLPLDNPL-------VGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDILH 200

  Fly   336 VDLDVVPQMTCKQ---IYRKERRLPRGIIEGQFCAGYLPGGRD--TCQGDSGGPIHALLPEYNCV 395
            :|::::|:..|::   |:::|          ..|||.|....|  .|.||:|.|:     .:|..
  Fly   201 IDVELLPRDICEKKVHIFKEE----------MMCAGNLNNTMDENPCAGDTGSPL-----IFNET 250

  Fly   396 AFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKI 430
            .|  |:.|:...|.:...|.:||.:|.::|||..|
  Fly   251 VF--GVVSYRVGCGSKTLPSIYTNVYMHMDWINGI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 54/228 (24%)
Tryp_SPc 186..427 CDD:214473 52/225 (23%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 54/228 (24%)
Tryp_SPc 60..280 CDD:214473 52/225 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.