DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG11529

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:221 Identity:74/221 - (33%)
Similarity:114/221 - (51%) Gaps:35/221 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 CGGALVSELYVLTAAHCATSGSKPPDMVRLGARQLNETSATQQDIKILII-----VLHPKYRSSA 279
            |||.|:.:.::|||.|| |.|....| |.||.:.:.:|..:..    |::     ::|.::....
  Fly    59 CGGTLLDKRWILTAGHC-TMGVTHYD-VYLGTKSVEDTEVSGG----LVLRSNKFIVHERFNPET 117

  Fly   280 YYHDIALLKLTRRVKFSEQVRPACL---WQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVV 341
            ..:||||:||.:.|.|:.:::||.|   ::..:....:|||:|||....: ..|::::..:|.|:
  Fly   118 AANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWGAMVEM-TNSDSMQYTELKVI 181

  Fly   342 PQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRD--TCQGDSGGPIHALLPEYNCVAFVVGITSF 404
            ....|.|.|..       :..|..||   .|.:|  .|.||||||:  :|.:   ...|||||||
  Fly   182 SNAECAQEYDV-------VTSGVICA---KGLKDETVCTGDSGGPL--VLKD---TQIVVGITSF 231

  Fly   405 GKF--CAAPNAPGVYTRLYSYLDWIE 428
            |..  |.. |.||.:||:..||||||
  Fly   232 GPADGCET-NIPGGFTRVTHYLDWIE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 74/221 (33%)
Tryp_SPc 186..427 CDD:214473 71/218 (33%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 74/221 (33%)
Tryp_SPc 37..255 CDD:214473 71/218 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.