DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG18180

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:109/250 - (43%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALG-WTQGSGSKDQDIKWGCGGA--LVSELYVLTAAHCATSGSKPPDMV 247
            ||.|.|...|..|::..|. .|.||.|       |..||  :::..::||||||.|.     |.|
  Fly    36 IVNGYPAPEGKAPYIVGLFIRTDGSNS-------GAVGAGTIIANDWILTAAHCLTG-----DYV 88

  Fly   248 RLG-ARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVR----PACLWQL 307
            .:. ........|.:|.::....:.||.:.|.. ..||.|:: |..|.|:..:.    |:...|.
  Fly    89 EIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQG-GRDIGLIR-TPHVDFNGLINKIPLPSMNEQN 151

  Fly   308 PELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPG 372
            ...|....||.|||..: .|..::.|:.||:.::....|:|.|       ..:.....|..: ..
  Fly   152 DRYQDTWCVACGWGGMD-NGNLADWLQCVDVQIISNSECEQAY-------GSVASTDMCTRH-AD 207

  Fly   373 GRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWI 427
            |:..|.||||||   |:...|  |.:||:.:|.. .:..:.|..|||:..||:||
  Fly   208 GKSVCGGDSGGP---LVTHDN--ARLVGVITFAS-VSCHDGPSGYTRVSDYLEWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 71/249 (29%)
Tryp_SPc 186..427 CDD:214473 70/248 (28%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 70/248 (28%)
Tryp_SPc 36..259 CDD:238113 71/249 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.