DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG8329

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:308 Identity:79/308 - (25%)
Similarity:115/308 - (37%) Gaps:74/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LADKHVLAQRISATKCQEYNAAARRLHLTDTGRTFSGKQCVPSVPLIVGGTPTRHGLFPHMAALG 204
            ::.|.||.....||.|...|.       ..|.....|.:     .:||.|.|...|..|:...|.
  Fly     1 MSKKLVLLLLFVATVCAHRNR-------NRTAHHGGGPK-----DIIVNGYPAYEGKAPYAVGLR 53

  Fly   205 WTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLGAR-----QLNETSATQQDI 264
            ...|:..         ||:::...:|||||||.|:.|.   .:..|:.     ||..|.......
  Fly    54 MNNGAVG---------GGSVIGNNWVLTAAHCLTTDSV---TIHYGSNRAWNGQLQHTVNKNNFF 106

  Fly   265 KILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACL-------------WQLPELQIPTVV 316
            :      ||.|.:|| .|||.|:: |..|.|:..:....|             |         .|
  Fly   107 R------HPGYPNSA-GHDIGLIR-TPYVSFTNLINKVSLPKFSQKGERFENWW---------CV 154

  Fly   317 AAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDS 381
            |.|||... .|..::.|:.:|:.|:....|.:.|        |.:...........|:..|.|||
  Fly   155 ACGWGGMA-NGGLADWLQCMDVQVISNGECARSY--------GSVASTDMCTRATDGKSVCGGDS 210

  Fly   382 GGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEK 429
            ||   ||:...|.:.  ||:.:|... ...:.|..|||:..:||||.:
  Fly   211 GG---ALVTHDNPIQ--VGVITFASI-GCKSGPSGYTRVSDHLDWIRE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 70/262 (27%)
Tryp_SPc 186..427 CDD:214473 68/258 (26%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 70/262 (27%)
Tryp_SPc 35..250 CDD:214473 68/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.