DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG3088

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:257 Identity:68/257 - (26%)
Similarity:112/257 - (43%) Gaps:50/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 LIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRL 249
            :|..|:|...|..|::..:.:.|.:       .| |.|.::.:.::||:|.|.|..|..  .:..
  Fly    28 IITNGSPAYEGQAPYVVGMAFGQSN-------IW-CSGTIIGDTWILTSAQCLTGSSGV--TIYF 82

  Fly   250 GARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPT 314
            ||.:|::...|       :.|...:|.:...:  :||:::. ||.||.:|....   ||.|:..:
  Fly    83 GATRLSQAQFT-------VTVGTSEYVTGNQH--LALVRVP-RVGFSNRVNRVA---LPSLRNRS 134

  Fly   315 -------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPG 372
                   ....|||.|.|....::||:.|||.::....|...|...      .:..|......|.
  Fly   135 QRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGST------TVSDQILCTRTPS 193

  Fly   373 GRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNA-----PGVYTRLYSYLDWIEK 429
            ||.||.||:|.|   |:.:.:  :.||||::|    .|.|.     |..:.|:.|.||||.:
  Fly   194 GRSTCFGDAGSP---LITKQD--STVVGISAF----VASNGCTLGLPAGFARITSALDWIHQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 68/256 (27%)
Tryp_SPc 186..427 CDD:214473 66/252 (26%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 68/254 (27%)
Tryp_SPc 29..244 CDD:214473 66/252 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437016
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.