DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Jon66Ci

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:270 Identity:67/270 - (24%)
Similarity:105/270 - (38%) Gaps:83/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250
            |..|.|...|..|:...||::.|         |.|||:::|..:||||.||....:.   .|..|
  Fly    37 ITNGYPAEEGKAPYTVGLGFSGG---------WWCGGSIISNEWVLTAEHCIGGDAV---TVYFG 89

  Fly   251 ARQLNETSATQQDIKILIIVLHPKYRSSAYY-----------H---DIALLKLTRRVKFSEQVRP 301
            |                      .:|::|.:           |   ||||:::. .|.|...|. 
  Fly    90 A----------------------TWRTNAQFTHWVGSGNFITHGSADIALIRIP-HVDFWHMVN- 130

  Fly   302 ACLWQLPELQIPT------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKER 354
                   ::::|:            .||.|||.|.......:.|:.|||.::....|...|    
  Fly   131 -------KVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYY---- 184

  Fly   355 RLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSF--GKFCAAPNAPGVY 417
              ..|.:........:..|:.||.||||||:..     :..:.:||:|::  |..|.|.: |..:
  Fly   185 --GTGTVGDNIICVRVVDGKGTCGGDSGGPLVT-----HDGSKLVGVTNWVSGAGCQAGH-PAGF 241

  Fly   418 TRLYSYLDWI 427
            .|:..:||||
  Fly   242 QRVTYHLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 67/270 (25%)
Tryp_SPc 186..427 CDD:214473 65/268 (24%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 65/268 (24%)
Tryp_SPc 37..254 CDD:238113 67/270 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436976
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.