DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG33465

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:222 Identity:67/222 - (30%)
Similarity:99/222 - (44%) Gaps:33/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 CGGALVSELYVLTAAHCATSGSKPPDMVRLGA-RQLNETSA--TQQDIKILIIVLHPKYRSSAYY 281
            |.|.||.:|:|||||.|.:..|:.  .|..|. .|..:.|.  ..:...:.:.:.|..:|.:...
  Fly    59 CDGTLVHKLFVLTAASCISKDSQL--YVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGV 121

  Fly   282 HDIALLKLTRRVKFSEQVRPACLWQLPELQIPTVVAAGWGRTEFLG-------AKSNALRQVDLD 339
            :||.||:|...|.....:||.|:     :....|.:|.:.|.|..|       |.|...:.|.|.
  Fly   122 NDIGLLRLYGEVTHYAHIRPICI-----ILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLS 181

  Fly   340 VVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDT--CQGDSGGPIHALLPEYNC--VAFVVG 400
            ......|   :|..:.||  |.||||||    |.||.  |:.:||.|:.|.. .|..  :...||
  Fly   182 QKKPFEC---HRNGQLLP--INEGQFCA----GNRDRSFCRSNSGSPLTADF-TYGVKNITVQVG 236

  Fly   401 ITSFGKFCAAPNAPGVYTRLYSYLDWI 427
            :.|:|....:|.:  |||.:.::.|||
  Fly   237 LVSYGSELCSPTS--VYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 67/222 (30%)
Tryp_SPc 186..427 CDD:214473 65/220 (30%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 67/222 (30%)
Tryp_SPc 46..261 CDD:214473 65/220 (30%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.