DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Jon65Ai

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:259 Identity:73/259 - (28%)
Similarity:105/259 - (40%) Gaps:59/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250
            |..|.|...|..|::..||:::..|.     .| |||:::...:|:||.|| |.|.:.. .:..|
  Fly    38 ITMGYPAYEGKVPYIVGLGFSKNGGG-----TW-CGGSIIGNTWVMTAKHC-TDGMESV-TIYYG 94

  Fly   251 ARQLNETSATQQDIKILIIVLHPKYRSSAYYH---DIALLKLTRRVKFSEQVRPACLWQL-PELQ 311
            |....:...|           |...||....|   ||:|:: |..|.|         |.| .:::
  Fly    95 ALWRLQAQYT-----------HWVGRSDFIEHGSGDISLIR-TPHVDF---------WSLVNKVE 138

  Fly   312 IPT------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQ 364
            :|.            .:.:|||:|...|..|..|..||:.:.....|:..|        |...|.
  Fly   139 LPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENYY--------GSFSGD 195

  Fly   365 FCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAA-PNAPGVYTRLYSYLDWI 427
            ......|..:.||.||||||:  ::.:.|   ..|||.|||..... .|.|....|:.||||||
  Fly   196 LICIPTPENKGTCSGDSGGPL--VIHDGN---RQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 73/259 (28%)
Tryp_SPc 186..427 CDD:214473 71/257 (28%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 71/257 (28%)
Tryp_SPc 41..257 CDD:238113 72/256 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436956
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.