DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG10477

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:118/260 - (45%) Gaps:38/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 VPSVP-LIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKP 243
            |||:. .|..|.......||:...|.:...:||      |.|||::::..:|||||||....|..
  Fly    33 VPSIDGRITNGNKAAANQFPYQVGLSFKSSAGS------WWCGGSIIANTWVLTAAHCTKGASSV 91

  Fly   244 P----DMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLK---LTRRVKFSEQVRP 301
            .    ..||..|:...:.|:::       .|.|..|.::...:||:|:|   :|..|..::...|
  Fly    92 TIYYGSTVRTSAKLKKKVSSSK-------FVQHAGYNAATLRNDISLIKTPSVTFTVSINKIALP 149

  Fly   302 ACLWQLPELQIPTVVAAGWGRTEFLG-AKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQF 365
            |...........|.||:|||||.... |.:..|:.....|:....|::.:...     .:..|..
  Fly   150 AIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSS-----VVTSGVI 209

  Fly   366 CAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSF--GKFCAAPNAPGVYTRLYSYLDWIE 428
            |...: ..:.|||||||||: ||...      ::|:|||  .|.| ..|||..:||:.||||||:
  Fly   210 CVESI-NKKSTCQGDSGGPL-ALNNR------LIGVTSFVSSKGC-EKNAPAGFTRVTSYLDWIK 265

  Fly   429  428
              Fly   266  265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 76/253 (30%)
Tryp_SPc 186..427 CDD:214473 74/250 (30%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 74/251 (29%)
Tryp_SPc 40..267 CDD:238113 76/253 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.