DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG15873

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:261 Identity:72/261 - (27%)
Similarity:109/261 - (41%) Gaps:46/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 LIVGG-TPTRHGLFPHMAAL---GWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCAT---SGSK 242
            ||.|| .|..:.|..|:.::   .:.:..|...     .|.|.|||...|||||||.|   ..|.
  Fly    35 LISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNH-----FCSGVLVSSRAVLTAAHCLTDRYKASM 94

  Fly   243 PPDMVRLGARQLNETSA-TQQDIK-ILIIVLHPKYRSSAYY--HDIALLKLTRRVKFS-EQVRPA 302
            .|..:|:....:...:. .:.|.: :..:|:||:|..   |  :|:|:|:|:.||:.| ..|.|.
  Fly    95 NPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYER---YKKNDLAILRLSERVQSSNHDVLPL 156

  Fly   303 CLWQLPELQI-PTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFC 366
            .:.:...:.. .|.:..|||:....|..||.|..:|:.:.|...|::.|            ..|.
  Fly   157 LMRKTANVTYGDTCITLGWGQIYQHGPYSNELVYLDVILRPPSLCQKHY------------DTFT 209

  Fly   367 AGY----LPGGRD-TCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDW 426
            |.:    .|.|.. .|.||.|||:       .|...:.|:......||...|....:.|| |.||
  Fly   210 ADHNVCTEPVGESMNCAGDMGGPL-------LCKGALFGLIGGHMGCAGGKAMKFLSFLY-YKDW 266

  Fly   427 I 427
            |
  Fly   267 I 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 71/260 (27%)
Tryp_SPc 186..427 CDD:214473 69/258 (27%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 62/240 (26%)
Tryp_SPc 59..250 CDD:238113 56/217 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.