DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG30283

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:258 Identity:80/258 - (31%)
Similarity:124/258 - (48%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 SVPL----IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSK 242
            :||:    |:||........|.||.:   .|.|.      :.|||.|::..:|||:|||..:|..
  Fly    35 TVPISQFKILGGHNAPVASAPWMAMV---MGEGG------FHCGGTLITNRFVLTSAHCIANGEL 90

  Fly   243 PPDMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYY--HDIALLKLTRRVKFSEQVRPACLW 305
               .||||   :.|..|..|...:..:.:|..|    |:  ||:|||:|.:||.:|:.:.|.||.
  Fly    91 ---KVRLG---VLEREAEAQKFAVDAMFVHTDY----YFDQHDLALLRLAKRVHYSDNISPICLL 145

  Fly   306 QLP-----ELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQF 365
            ..|     :..|......|||:|| ..:.|..|::..|..:.:..|.:.|..::     |.....
  Fly   146 LDPLVKNIDEHIVKFRTYGWGKTE-SRSSSRMLQKTSLFNLHRSECAKQYPHQQ-----INRNHI 204

  Fly   366 CAGYLPGGRDTCQGDSGGPIHALLP-EYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWI 427
            ||.  ....:||.||||||:.|::. ::..:.|..|:||||.  |..:...|:|.:.::||||
  Fly   205 CAE--SANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGH--ADCSKATVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 78/250 (31%)
Tryp_SPc 186..427 CDD:214473 76/248 (31%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 76/249 (31%)
Tryp_SPc 43..266 CDD:238113 78/250 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.