DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG10764

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:254 Identity:87/254 - (34%)
Similarity:124/254 - (48%) Gaps:39/254 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDM-V 247
            |.|.||..........|||:     ..|.|    :.|||.::...:||:||||...|.   |: |
  Fly    36 PKISGGDDAAEPNSIWMAAI-----FNSSD----FQCGGTIIHMRFVLSAAHCLVRGY---DLYV 88

  Fly   248 RLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPEL-- 310
            |||||.:||.:|....|.:.:   |..:.:|.|.:||.||:|:..:.::.:|:|.|::..|.|  
  Fly    89 RLGARNINEPAAVHTVINVFV---HHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKG 150

  Fly   311 ---QIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPG 372
               ::.|..|.|||...  |..|..|:.:.|..:.:..||      |:|...:...|.|||...|
  Fly   151 SVEKLKTFRALGWGNRN--GKLSIMLQTIYLLHLKRNECK------RKLNFNLNSRQICAGTKNG 207

  Fly   373 GRDTCQGDSGGPI--HALLPEYNCVAFVVGITSFGKFCAAP--NAPGVYTRLYSYLDWI 427
              |||:||||||:  :.|.|........:||.|||.    |  ...||||.:.||:|||
  Fly   208 --DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGD----PECRGVGVYTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 86/252 (34%)
Tryp_SPc 186..427 CDD:214473 84/250 (34%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 84/251 (33%)
Tryp_SPc 38..263 CDD:238113 86/252 (34%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.