DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG4927

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:381 Identity:129/381 - (33%)
Similarity:175/381 - (45%) Gaps:81/381 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 FCRRSFDGRSGYC--ILAYQC------LHVIREYRVHGTRIDICTHRNNVPVICCPLADK-HVLA 147
            ||    |..:|.|  :.|..|      ||:||.:      :..|...|:  ::||.|.:. ...:
  Fly    21 FC----DNGTGECKELSATDCPSIFFNLHLIRNF------VKYCDKSNH--IVCCLLPNNMQPQS 73

  Fly   148 QRISAT--------KCQEYNAAARRLHLTDTGRTFSGKQCVPSVPLIVGGTPTRHGLFPHMAALG 204
            |:.||.        :|:.:|      .:..:.||         .|.||||.......||.||.||
  Fly    74 QQFSANIGLRRFEKECRRFN------EIRTSCRT---------TPFIVGGAKAAGREFPFMALLG 123

  Fly   205 WTQGSGSKDQDIKWGCGGALVSELYVLTAAHC-ATSGSK----------PPDMVRLGARQLNETS 258
               ..|.....|.|.||..::...:||||||| .||.:|          |..:||||....|.|:
  Fly   124 ---QRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTT 185

  Fly   259 --ATQQDIKILIIVLHPKY----RSSAYYHDIALLKLTRRVKFSEQVRPACLWQLP------ELQ 311
              |..||.::|..|:||.|    .:.:..:|||:::|.....|||.|.|||   ||      :||
  Fly   186 DDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPAC---LPLDGGNEQLQ 247

  Fly   312 IPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDT 376
               |.|||||.|...|..|:.|.:|.||......|.|  |.|.::.   :..|.|||......||
  Fly   248 ---VAAAGWGATSESGHASSHLLKVSLDRYDVAECSQ--RLEHKID---VRTQLCAGSRSTSADT 304

  Fly   377 CQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKIAF 432
            |.||||||:....|.|:|:..|:||||:|..|.....|.|||:::.|.||||.|.:
  Fly   305 CYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIENIVW 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829 13/53 (25%)
Tryp_SPc 186..430 CDD:238113 104/266 (39%)
Tryp_SPc 186..427 CDD:214473 101/263 (38%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 104/266 (39%)
Tryp_SPc 105..355 CDD:214473 101/263 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.