DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG12133

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:331 Identity:101/331 - (30%)
Similarity:144/331 - (43%) Gaps:87/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 CCPL--ADKHVLAQRISATKCQEYNAAARRLHLTDTGRTFSGKQCVPSVP--LIVGGTPTRHGLF 197
            |||:  .||                       |.|:      :.|..|.|  .||||...:...|
  Fly    38 CCPMVAGDK-----------------------LPDS------RVCGQSPPSSYIVGGMEAQSNQF 73

  Fly   198 PHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLGARQL-NETSAT- 260
            |....||: :...:|.:.... |.|:|::..||||||||..........||||.... |:...| 
  Fly    74 PWTVLLGY-EAYTAKQRPSPM-CAGSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTW 136

  Fly   261 -----------QQDIKILIIVLHPKY--RSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQI 312
                       ..||.:.:.|.|.:|  |:..:|:|||||:|..|||::.|:||.|:|  |.:::
  Fly   137 LPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIW--PGIEL 199

  Fly   313 PT-------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEG--QFCA- 367
            .|       ...||||.:. |..||..|||..:..:....|.      .|.|..:::.  |.|| 
  Fly   200 STSSFKNFPFQIAGWGDSG-LQQKSTVLRQGTISGMSPDECL------NRYPTLLVDKDIQICAM 257

  Fly   368 GYLPGGRDTCQGDSGGPIHALLPE-----YNCVAFVVGITSFGKFCAAPNA----PGVYTRLYSY 423
            |:  .|.||..||||.|:.|.:..     |    ::.||||:|   ..|::    |.|||:..||
  Fly   258 GW--DGTDTGLGDSGSPLMASVGRGADQFY----YLAGITSYG---GGPSSYGYGPAVYTKTSSY 313

  Fly   424 LDWIEK 429
            .:||:|
  Fly   314 YEWIKK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829 1/1 (100%)
Tryp_SPc 186..430 CDD:238113 91/278 (33%)
Tryp_SPc 186..427 CDD:214473 88/274 (32%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 91/278 (33%)
Tryp_SPc 62..317 CDD:214473 88/274 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.