DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Jon44E

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:261 Identity:76/261 - (29%)
Similarity:118/261 - (45%) Gaps:57/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250
            |..|.|...|..|::..|.:..|.        :.|||:::...:|||||||..|.:..  ::..|
  Fly    41 ITNGYPAYEGKIPYIVGLSFNDGG--------YWCGGSIIDHTWVLTAAHCTNSANHV--LIYFG 95

  Fly   251 ARQLNETSAT----QQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQL-PEL 310
            |...:|...|    :.|     ::.||.: :....:||||:::. .|.|         |.| .::
  Fly    96 ASFRHEAQYTHWVSRSD-----MIQHPDW-NDFLNNDIALIRIP-HVDF---------WSLVNKV 144

  Fly   311 QIPT------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEG 363
            ::|:            .||:|||.|:.....||.|..||:.::....|:..|....     |.:.
  Fly   145 ELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNY-----ITDN 204

  Fly   364 QFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSF--GKFCAAPNAPGVYTRLYSYLDW 426
            ..|.. ..||:.:|.||||||:  :|.:.|   .:|||.||  |:.|.| ..|..:||:..||||
  Fly   205 TICIN-TDGGKSSCSGDSGGPL--VLHDNN---RIVGIVSFGSGEGCTA-GRPAGFTRVTGYLDW 262

  Fly   427 I 427
            |
  Fly   263 I 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 76/261 (29%)
Tryp_SPc 186..427 CDD:214473 74/259 (29%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 74/259 (29%)
Tryp_SPc 41..266 CDD:238113 76/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436964
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.