DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and try-9

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:260 Identity:64/260 - (24%)
Similarity:97/260 - (37%) Gaps:72/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 TQGSG---------SKDQDIKWGCGGALVSELYVLTAAHCATSGSKP-PDMVRLGARQ------- 253
            :.|||         |:::.::.|. |.|||..:::||||.......| ||......|:       
 Worm     6 SDGSGSFRNGGNKFSENEFVQHGT-GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDY 69

  Fly   254 ------LNETSATQQDIKILIIVLHPK-----------YRSSAY----------YHDIALLKLTR 291
                  :|.|.|..:..|    .||.|           |....|          ::|||:.:|..
 Worm    70 KNFVAFVNVTCAVPEMCK----GLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEE 130

  Fly   292 RVKFSEQVRPACLWQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIY----RK 352
            .::||:.:.||||...|  :||.:...|:   :..|..    |.....|:.....|.:|    ..
 Worm   131 PIEFSKDIFPACLPSAP--KIPRIRETGY---KLFGYG----RDPSDSVLESGKLKSLYSFVAEC 186

  Fly   353 ERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVY 417
            ....|.|   |.:|...:..|. :|.||||..:.......| |..:||:.|.|..|     |.:|
 Worm   187 SDDFPYG---GVYCTSAVNRGL-SCDGDSGSGVVRTSDTRN-VQVLVGVLSAGMPC-----PELY 241

  Fly   418  417
             Worm   242  241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 64/260 (25%)
Tryp_SPc 186..427 CDD:214473 64/260 (25%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 56/224 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.