DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and scaf

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:316 Identity:77/316 - (24%)
Similarity:117/316 - (37%) Gaps:98/316 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 NVPVICCPLADKHVLAQRISATKCQEYN------------------AAARRLHLTDTGRTFS--- 175
            |||        || .|:..||..|...|                  .||.|:.|||..:|.:   
  Fly   336 NVP--------KH-FAKCASALVCTSENFCNAIGVLSETPVELSPMEAAFRVPLTDCLQTENGSP 391

  Fly   176 GKQC-----VPSVPL-IVGGTPTRHGLFPHMAALGWTQGSGSKDQD-----IKWG---------- 219
            ||.|     |...|: :.|...||:..         |:.:|.||.|     |.|.          
  Fly   392 GKCCRDPNYVDPWPVNLAGVCATRNKR---------TKPTGVKDLDANFAEIPWQAMILRESSKT 447

  Fly   220 --CGGALVSELYVLTAAHCATSGSKPPDM-VRLGARQLNETSATQ--QDIKILIIVLHPKYRSSA 279
              ||||::.:.:||::|.| .:|....|: |:.|..:|..|:...  |...:..:.:||.|..|.
  Fly   448 LICGGAIIGDQFVLSSASC-VNGLPVTDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPST 511

  Fly   280 YYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQM 344
            ..||:|:::|.||::|:..::|.|:.............:|||:......:..||..| .|.:|| 
  Fly   512 NSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQCFTSGWGKQALSIHEEGALMHV-TDTLPQ- 574

  Fly   345 TCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVG 400
                                        .|..|..||.....|  .:::...|.||
  Fly   575 ----------------------------ARSECSADSSSVCSA--TKFDSCQFDVG 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829 3/6 (50%)
Tryp_SPc 186..430 CDD:238113 55/235 (23%)
Tryp_SPc 186..427 CDD:214473 55/235 (23%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 48/206 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.