DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG17572

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:403 Identity:106/403 - (26%)
Similarity:157/403 - (38%) Gaps:95/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GDDAEVRTSVSEGLHEGAFCRRSFDGRSGYCILAYQCLHVIREYRVHGTRIDICTHRNNVPVICC 138
            |:..::...||.|..|.....|| :..:|:.:.|.....|::.....|     |    :|...|.
  Fly    22 GEFEKLLVPVSHGSAEQRSGARS-NETTGHSVAARSYYDVVQNAGQTG-----C----SVGTECT 76

  Fly   139 PLADKHVLAQRISATKCQEYNAAARRLHLTDTGRTFSGKQ------CVPSVPL---------IVG 188
            ||.|...|...:           ||..:..|......|..      |.||.||         :|.
  Fly    77 PLHDCTALIYEV-----------ARSCYYGDKSLYCGGSSEELPYVCCPSSPLEKNQVCGKSLVQ 130

  Fly   189 GTPTRH-----GLFPHMAALGWTQ-GSGSKDQDIKWGCGGALVSELYVLTAAHCATS-------- 239
            |    |     |.:|.:|.:|:.. .:|:    ..:.|.||:::...:|||||||.:        
  Fly   131 G----HFYKGLGSYPFVARIGFKHVNTGA----FAYPCAGAVIARRVILTAAHCALAKADGHRLS 187

  Fly   240 --------GSKPPDMVRLG---ARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRV 293
                    .|..||....|   .|.:|..        |..:::||.|:...|:||||||.|...:
  Fly   188 SVRVGEYDTSSDPDCANTGFCAPRSVNHA--------ISHVIVHPDYKQGQYHHDIALLVLKTPL 244

  Fly   294 KFSEQVRPACLWQLPELQIPTVVA-----AGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKE 353
            .:|...:|.|   |.:.:...||.     ||||:......:...:..:|:.:.....|.:.|...
  Fly   245 NYSVATQPIC---LQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGST 306

  Fly   354 RRL--PRGIIEGQF-CAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGK-FCAAPNAP 414
            ..|  |.. ||||: |||  ..|:|.|||..|.|   |..:.|.:...:||.|||. .|.....|
  Fly   307 GALESPNS-IEGQWMCAG--GEGKDVCQGFGGAP---LFIQENGIFSQIGIMSFGSDNCGGLRIP 365

  Fly   415 GVYTRLYSYLDWI 427
            .|||.:..:.:||
  Fly   366 SVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829 9/45 (20%)
Tryp_SPc 186..430 CDD:238113 79/276 (29%)
Tryp_SPc 186..427 CDD:214473 77/274 (28%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 76/262 (29%)
Tryp_SPc 138..378 CDD:214473 74/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.