DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG4650

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:255 Identity:67/255 - (26%)
Similarity:107/255 - (41%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 LIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVR- 248
            |:..|....:...|.||.|        ...::.:.|||.:::|..|||||||..:..:....:. 
  Fly    30 LLTNGKIANNISSPWMAYL--------HTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARIGE 86

  Fly   249 -LGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPAC-----LWQL 307
             :|....|:|..::..:....|  |..|.::...:|||:|.|...:.||:.:||.|     :|:.
  Fly    87 FIGTDDANDTMLSEYQVSQTFI--HSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRK 149

  Fly   308 PELQIPTVVAAGWG----RTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAG 368
            ....|..:..|.||    |.|     |:|.|..|:...|...|..:.      ...|:..|||||
  Fly   150 YIDNIQVLSGAQWGLPNDRNE-----SDAFRITDIRRQPANMCSTLN------GTAILSSQFCAG 203

  Fly   369 YLPGGRDTCQGDSGGPIHALLPEYNCVAFV-VGITSFGKFCAAPNAPGVYTRLYSYLDWI 427
              ......|..|...|:.|::...|...:| :||.:..:.|   ....|||.:.|:.|:|
  Fly   204 --DSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTNQKC---KRASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 66/254 (26%)
Tryp_SPc 186..427 CDD:214473 65/252 (26%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/250 (26%)
Tryp_SPc 33..258 CDD:304450 65/250 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.