DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Jon25Biii

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:280 Identity:72/280 - (25%)
Similarity:107/280 - (38%) Gaps:73/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 FSGKQCVPSVP-------LIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVL 231
            |..|..|..:|       .|..|.....|..|:...||::.|         |.|||::::..:||
  Fly    18 FDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGG---------WWCGGSIIAHDWVL 73

  Fly   232 TAAHCATSGSKPPDMVRLGA-----RQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTR 291
            ||.||.  |.....:|..||     .|...|......||          .|:|   ||||:::. 
  Fly    74 TAEHCI--GDAASVIVYFGATWRTNAQFTHTVGNGNFIK----------HSNA---DIALIRIP- 122

  Fly   292 RVKFSEQVRPACLWQLPELQIPT------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQM 344
            .|.|...|.        ::::|:            .||.|||.|.......:.|:.|||.:|...
  Fly   123 HVDFWHMVN--------KVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNE 179

  Fly   345 TCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSF--GKF 407
            .|...|        |.:...........|:..|.||||||:..     :..:.:||:::|  ...
  Fly   180 ECGWTY--------GSVGDNVICTRTVDGKSICGGDSGGPLVT-----HDGSKLVGVSNFVSSNG 231

  Fly   408 CAAPNAPGVYTRLYSYLDWI 427
            |.: .||..:.|:..:||||
  Fly   232 CQS-GAPAGFQRVTYHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 68/261 (26%)
Tryp_SPc 186..427 CDD:214473 66/259 (25%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 66/260 (25%)
Tryp_SPc 37..253 CDD:238113 68/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.