DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Hayan

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:439 Identity:123/439 - (28%)
Similarity:190/439 - (43%) Gaps:90/439 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LHLI---LQTPNLEALDALEI-INYQTTKYTIPEVWKEQ------PVATIGEDVDDQDTEDEESY 70
            :||:   |:...::...|.|: :..|||....|.....|      |....|:| .|:||:.:|.:
  Fly   262 IHLVNDRLREQGMQIEPAREVPMVLQTTPTPTPAPTPTQLIDPFEPYRFRGQD-RDKDTQPQEPW 325

  Fly    71 LKFGDDAEVRTSVSEGLHEGAFCRRSFDGRSGYCILAYQCLHVIREYRVHGTRIDICTHRNNVPV 135
            ....::.:...:.|                            :........|..:....|.|:| 
  Fly   326 NDVSNNLDADPAPS----------------------------IFNPAETRPTTPNPNPSRVNLP- 361

  Fly   136 ICCPLADKHVLAQRISATKCQEYNAAARRL--HLTDTGRTFSGKQCVPSVPLIVGGTPTRHGLFP 198
                  :|    :|.|...|::..:..:.|  |:.|                   |.....|::|
  Fly   362 ------EK----ERPSVAACEKIRSGGKPLTVHILD-------------------GERVDRGVYP 397

  Fly   199 HMAALGWTQ-GSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLGARQLNETSATQQ 262
            ||||:.:.. ||.:      :.|||:|::..:|||||||..|....|..|||||..:.......|
  Fly   398 HMAAIAYNSFGSAA------FRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPEPGYQ 456

  Fly   263 DIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPTV----VAAGWGRT 323
            ||.::.:.:||.|..|:.|:|||:|:|....|.|:.:|||||:  .:...|..    ..||||..
  Fly   457 DINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLY--TDRSDPPANYKYFVAGWGVM 519

  Fly   324 EFLG-AKSNALRQVDLDVVPQMTCKQIYRKE----RRLPRGIIEGQFCAGYLPGGRDTCQGDSGG 383
            .... |.|..|.:..||:||...|...:.::    |.|.||:|..|.||......:|.|||||||
  Fly   520 NVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGG 584

  Fly   384 PIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKIAF 432
            |:...:.:.:....:||:.|.|..||. ..||:|||:.|:||:||.|.:
  Fly   585 PLILEIDDVDGTYSIVGVISSGFGCAT-KTPGLYTRVSSFLDYIEGIVW 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829 4/45 (9%)
Tryp_SPc 186..430 CDD:238113 93/253 (37%)
Tryp_SPc 186..427 CDD:214473 91/250 (36%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 93/270 (34%)
Tryp_SPc 385..630 CDD:238113 94/272 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.