DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG8952

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:267 Identity:69/267 - (25%)
Similarity:113/267 - (42%) Gaps:61/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWG---CGGALVSELYVLTAAHCATSGSKPPDMV 247
            ||.|:..:.|.||....|       .:|   .|.   |||:::|:.:||||||| |:|.....::
  Fly    38 IVSGSDAKLGQFPWQVIL-------KRD---AWDDLLCGGSIISDTWVLTAAHC-TNGLSSIFLM 91

  Fly   248 -----RLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQL 307
                 ...|..||.||..        |::||.| :....:|::|::|...:.||..:      |.
  Fly    92 FGTVDLFNANALNMTSNN--------IIIHPDY-NDKLNNDVSLIQLPEPLTFSANI------QA 141

  Fly   308 PEL------------QIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGI 360
            .:|            .:.|:...|:...|:|. .|..|....::::....|..||.|     ..:
  Fly   142 IQLVGQYGDSIDYVGSVATIAGFGYTEDEYLD-YSETLLYAQVEIIDNADCVAIYGK-----YVV 200

  Fly   361 IEGQFCA-GYLPGGRDTCQGDSGGPI---HALLPEYNCVAFVVGITSF-GKFCAAPNAPGVYTRL 420
            ::...|| |:......||.||||||:   :..:.::.    .:||.|| .:.......|..|.|:
  Fly   201 VDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQ----QIGINSFVAEDQCTYRLPSGYARV 261

  Fly   421 YSYLDWI 427
            .|:|.:|
  Fly   262 SSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 69/267 (26%)
Tryp_SPc 186..427 CDD:214473 68/265 (26%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 68/265 (26%)
Tryp_SPc 38..271 CDD:238113 69/267 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.