DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG31205

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:259 Identity:66/259 - (25%)
Similarity:108/259 - (41%) Gaps:48/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 PTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSG-SKPPDMVRLG---A 251
            ||.|.....:..:       :||......|.|.|:....|:|||||.:.. |:....|..|   :
  Fly    46 PTEHPWVVRIVGV-------TKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDS 103

  Fly   252 RQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIP--- 313
            ..:|..||         :.:||.|....:.:|:|:::||:.|.||:.|:|.||..:.|: :|   
  Fly   104 SNINLVSA---------VTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEM-VPGSE 158

  Fly   314 ----TVVAAGWGRTEFLGAKSNALRQVDLDVVPQMT-----CKQIYRKERRLPRGIIEGQFCAGY 369
                .::.||.....| ..:.:|.:::|..:  :||     .|:.:.|:.|.|..:|.|......
  Fly   159 TSNSKLIVAGLEGPSF-DRRHSATQRLDKRI--KMTYTKIDSKECHEKQARFPEELICGHTERSP 220

  Fly   370 LPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKIAFK 433
            |.|...|....:....|.|           ||...|.|.:..:..| |..:..:||||.|.:.|
  Fly   221 LSGSALTEASGTPRQFHLL-----------GIAVAGFFSSDLDHQG-YLNIRPHLDWISKNSSK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 64/254 (25%)
Tryp_SPc 186..427 CDD:214473 62/251 (25%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/138 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.