DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG11664

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:211 Identity:53/211 - (25%)
Similarity:88/211 - (41%) Gaps:27/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 GALVSELYVLTAAHCATSGSKPPDM-VRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIA 285
            |:|.|..||||.|||....:||.:: ||.|.|.:......:|   :..::.|||:......:|||
  Fly    49 GSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQ---VAGLLRHPKFSPLTLRNDIA 110

  Fly   286 LLKLTRRVKFSEQVRPACLWQLP----ELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTC 346
            :|::...:..|..:....|...|    .:..|....|||.....    :..|:.:.:.|.|:..|
  Fly   111 VLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNLMHI----AQPLKSMSVQVEPEKNC 171

  Fly   347 KQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAP 411
            :|.:.:       |..|..||. ...|...|.||||.|:.:       ...|.|:....:.|...
  Fly   172 RQWFPQ-------ISGGVICAS-ATMGEGLCYGDSGDPLIS-------GGEVCGLAIAFRKCGDK 221

  Fly   412 NAPGVYTRLYSYLDWI 427
            ..|.::|.::.:..:|
  Fly   222 RYPALFTDVHYHRAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 53/211 (25%)
Tryp_SPc 186..427 CDD:214473 52/209 (25%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 53/211 (25%)
Tryp_SPc 38..237 CDD:214473 52/209 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.