DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Gzmk

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:263 Identity:80/263 - (30%)
Similarity:120/263 - (45%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250
            |:||...:....|.||::   |..|      |..|||.|:...:|||||||.:.|..|  .|.||
  Rat    26 IIGGREVQPHSRPFMASI---QYRG------KHICGGVLIHPQWVLTAAHCYSRGHSP--TVVLG 79

  Fly   251 ARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPTV 315
            |..|::....:|..:|...:....::|..  :||.|:||....:.::.|      ||..|:....
  Rat    80 AHSLSKNEPMKQTFEIKEFIPFSGFKSGT--NDIMLIKLRTAAELNKHV------QLLHLRSKNY 136

  Fly   316 V-------AAGWGRTE-FLGAKSNALRQVDLDVVPQMTC-KQIYRKERRLPRGIIEGQFCAGYLP 371
            :       ..|||.|: .:...|:.|::|.:.::.:..| .|.|...:.:   |.:...|||...
  Rat   137 IRDGTKCQVTGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNHKPV---ITKDMICAGDRR 198

  Fly   372 GGRDTCQGDSGGPI------HALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRL-YSYLDWIE- 428
            |.:|:|:||||||:      |||:             |.|..|...|.|||||.| ..|..||: 
  Rat   199 GEKDSCKGDSGGPLICKGVFHALV-------------SGGYKCGISNKPGVYTLLTKKYQTWIKS 250

  Fly   429 KIA 431
            |:|
  Rat   251 KLA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 78/260 (30%)
Tryp_SPc 186..427 CDD:214473 76/256 (30%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 76/256 (30%)
Tryp_SPc 26..251 CDD:238113 78/259 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.