DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and TMPRSS12

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_872365.2 Gene:TMPRSS12 / 283471 HGNCID:28779 Length:348 Species:Homo sapiens


Alignment Length:309 Identity:99/309 - (32%)
Similarity:143/309 - (46%) Gaps:56/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 ATKCQEYNAAARRL--------HLTDTGRTFSGKQCVPSVPL--------IVGGTPTRHGLFPHM 200
            |...|:..|..:||        |..|.|          :.||        |:|||..:.|.:|.:
Human    38 AASSQQAEAVRKRLRRRREGGAHAEDCG----------TAPLKDVLQGSRIIGGTEAQAGAWPWV 92

  Fly   201 AALGWTQGSGSKDQDIKWG------CGGALVSELYVLTAAHCATSGSKPPDMVR-LGARQLNETS 258
            .:|           .||:|      |||.||.|.:|||||||....|.|..... :|...::...
Human    93 VSL-----------QIKYGRVLVHVCGGTLVRERWVLTAAHCTKDASDPLMWTAVIGTNNIHGRY 146

  Fly   259 ATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACL----WQLPELQIPTVVAAG 319
            ...:.|||..|::||.:...:|.:||||..|.:.|::::.::|.||    :|:.:......: :|
Human   147 PHTKKIKIKAIIIHPNFILESYVNDIALFHLKKAVRYNDYIQPICLPFDVFQILDGNTKCFI-SG 210

  Fly   320 WGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEG-QFCAGYLPGGRDTCQGDSGG 383
            ||||:..|..:|.|:..::..:.:..|     ...|...|||.. .||||...|..|||:|||||
Human   211 WGRTKEEGNATNILQDAEVHYISREMC-----NSERSYGGIIPNTSFCAGDEDGAFDTCRGDSGG 270

  Fly   384 PIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKIAF 432
            |:...||||... ||:||||:|..|.....||||.....|..|:.:..|
Human   271 PLMCYLPEYKRF-FVMGITSYGHGCGRRGFPGVYIGPSFYQKWLTEHFF 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 88/255 (35%)
Tryp_SPc 186..427 CDD:214473 87/252 (35%)
TMPRSS12NP_872365.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 6/24 (25%)
Tryp_SPc 78..316 CDD:238113 88/255 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BF5U
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.