DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG18420

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:281 Identity:86/281 - (30%)
Similarity:123/281 - (43%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 FSGKQCVPSVPL-----IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTA 233
            |...:|....||     ||.|........|.||.|     ..|.:|.|   |||.|:|...||||
  Fly    26 FLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFL-----HTSSNQFI---CGGTLISRRLVLTA 82

  Fly   234 AHCATSGSKPPDMVRLGA--------RQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLT 290
            |||....:  ..:||||.        |:.::.:.|.|         |..|..:.:.:|||||:|.
  Fly    83 AHCFIPNT--TIVVRLGEYNRKLKGYREEHQVNRTFQ---------HRFYDPNTHANDIALLRLV 136

  Fly   291 RRVKFSEQVRPACL-----WQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIY 350
            ..|.:...:||.|:     |:.....|..:...||||||.: ..|:.||.:|:...|...|..  
  Fly   137 SNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESM-HDSSELRTLDISRQPSKMCAF-- 198

  Fly   351 RKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFV-VGITSFGKFCAAPNAP 414
                   ..::..|||||  ....:.|.||:|||:.|::...|...|| |||....|.|   ..|
  Fly   199 -------GSVLSNQFCAG--NWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRC---QRP 251

  Fly   415 GVYTRLYSYLDWIEKIAFKQH 435
            .|:|.:.|::::|.:|...|:
  Fly   252 SVFTDVMSHIEFIRRIFLTQN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 80/257 (31%)
Tryp_SPc 186..427 CDD:214473 79/254 (31%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 79/255 (31%)
Tryp_SPc 43..267 CDD:238113 80/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.