DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG18636

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:265 Identity:72/265 - (27%)
Similarity:122/265 - (46%) Gaps:48/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250
            |:.|...::...|.|..|     ..:.|..:   |||:|:::..|||||||..:....  :.|||
  Fly    45 IINGHTAKYNSSPWMVFL-----HSTTDMFV---CGGSLITDKLVLTAAHCFIANQHL--VARLG 99

  Fly   251 ARQ-------------LNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPA 302
            ..:             ..|........|      |..|..:.:.:|||:|:|::.|.:.:.:||.
  Fly   100 EYERTRSEECTGYYCNFREEHMVDAGFK------HKLYDPNTHANDIAILRLSKSVVYRDNIRPI 158

  Fly   303 CL-----WQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIE 362
            |:     |:....:|..:.|.|||:|: :.:.|:||:.:|:...|...|.:.      :.:.|..
  Fly   159 CVVWDHRWRHYLDKIDLLTATGWGKTQ-MESDSDALQTLDIRRQPPDVCAKF------IGQTIAG 216

  Fly   363 GQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFV-VGITSF-GKFCAAPNAPGVYTRLYSYLD 425
            .|||||....  :.|.||||||:.|::...|...|| |||.|: .:.|   ....|:|.:.|:.:
  Fly   217 NQFCAGNWDS--NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAE 276

  Fly   426 WIEKI 430
            :|.::
  Fly   277 FILRV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 72/263 (27%)
Tryp_SPc 186..427 CDD:214473 71/260 (27%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/260 (27%)
Tryp_SPc 45..278 CDD:238113 71/260 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.