DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG33462

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:252 Identity:72/252 - (28%)
Similarity:106/252 - (42%) Gaps:46/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 PHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDM---VRLGARQLNETSA 259
            |.||.|...:|         :.|.|.|::.|:|||||||.     |.|:   ||||  :.|..:.
  Fly    48 PWMAYLETPKG---------FHCSGTLINHLFVLTAAHCV-----PDDLLITVRLG--EYNTKTK 96

  Fly   260 TQ----------QDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACL-----WQLPE 309
            ..          |:..:.:...|..|.::...:||.:|:|.|||::...:||.|:     :|.|.
  Fly    97 VDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPI 161

  Fly   310 LQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGR 374
            .|:.......|..|. ..|.|..||.:::|..|:.||.:||.......      |.|||....  
  Fly   162 DQLTWFTTTVWRETA-ANATSKVLRTMNIDRQPKETCSEIYGWNMTFE------QICAGNTLS-- 217

  Fly   375 DTCQGDSGGPIHALLPEYNCVAFV-VGITSFGKFCAAPNAPGVYTRLYSYLDWIEKI 430
            ..|..|||.|....:.......:| :||.|..|  ......|:...|.||.|||:::
  Fly   218 QLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVK--GQCQNSGILMDLLSYADWIKRV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 72/250 (29%)
Tryp_SPc 186..427 CDD:214473 70/247 (28%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 72/250 (29%)
Tryp_SPc 48..269 CDD:214473 70/247 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.