DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Sp212

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:257 Identity:68/257 - (26%)
Similarity:117/257 - (45%) Gaps:25/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 SVPLIVGGTPTRHGLFPHMAALGWTQGSGSKD-QDIKWGCGGALVSELYVLTAAHCATSGSKPPD 245
            :.|.||.|.....|.:|      |......|: :.:.:.|.|:|:|...|::||||....::...
  Fly   273 TTPFIVRGNEFPRGQYP------WLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRV 331

  Fly   246 MVRLGARQLNETSATQQDIK-ILIIVLHPKYRSSAYYH-DIALLKLTRRVKFSEQVRPACLWQLP 308
            :|.||...|::......::: ::.::.||.|.:.:|.. ||||:.:.|.|.|::.:.|.|:|.:.
  Fly   332 VVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVE 396

  Fly   309 ELQI--PTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLP 371
            ..:.  .|...|||||.|. .:::...|.|:.::.....|...:|...     :.|...|||...
  Fly   397 ASRTVSTTGFIAGWGRDED-SSRTQYPRVVEAEIASPTVCASTWRGTM-----VTERSLCAGNRD 455

  Fly   372 GGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAP----NAPGVYTRLYSYLDWIEK 429
            |. ..|.|||||   .|:.:......:.||.|.|:...|.    |...:|..|..:::||.:
  Fly   456 GS-GPCVGDSGG---GLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 67/253 (26%)
Tryp_SPc 186..427 CDD:214473 65/249 (26%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 67/253 (26%)
Tryp_SPc 277..511 CDD:214473 65/249 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.