DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG30323

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:267 Identity:54/267 - (20%)
Similarity:89/267 - (33%) Gaps:97/267 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 WG----CGGALVSELYVLTAAHCATSGSKPPDMVRLGARQLNETSATQQDIKILIIVLHPKYRSS 278
            ||    |.|:|:|..:|:|:..|.:  ::|.......:.:.|          :.::|..||....
  Fly    48 WGDNHFCAGSLLSAWWVVTSGCCVS--TRPESTPNQPSNRKN----------LRVVVFTPKRLKK 100

  Fly   279 A----YYH---------------DIALLKLTRRV---KFSEQVRPACLWQLPELQIPTV---VAA 318
            .    .||               ::|||||.|.|   :|:        ..|||.::.:.   .:.
  Fly   101 PSPKNIYHVQKIVLDESAISGCTELALLKLDRGVTGQRFA--------MMLPEKELNSTWLCNSL 157

  Fly   319 GWGRTEFL-------------------------GAKSNALRQVDLDVVPQMTCKQIYRKERRLPR 358
            ||||..::                         |..|:.|.|:....:.:..||....:      
  Fly   158 GWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSR------ 216

  Fly   359 GIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPG--VYTRLY 421
                 ..|.....|..:.||.|.|.|:.       |..|:.|:......|   :..|  .||.:|
  Fly   217 -----CLCMTSYTGRGNMCQQDLGSPLF-------CDHFLYGVARRVHTC---DDEGFMFYTNIY 266

  Fly   422 SYLDWIE 428
            ....:||
  Fly   267 QNRKFIE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 54/267 (20%)
Tryp_SPc 186..427 CDD:214473 52/264 (20%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 54/267 (20%)
Tryp_SPc 45..272 CDD:214473 52/264 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.