DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG30082

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:267 Identity:89/267 - (33%)
Similarity:122/267 - (45%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 VPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPP 244
            :|....||||.....|..|.:|.|       .|:..:.  |.|.|:::.:|||||||..|.... 
  Fly    34 LPPTNRIVGGRTADIGSNPWLAYL-------HKNSSLV--CTGTLITKRFVLTAAHCLHSFHLL- 88

  Fly   245 DMVRLGARQLNETSATQQDIKILIIVLHPKYR-SSAYYH-----------DIALLKLTRRVKFSE 297
             .||||.   .:||..........|..:.:|. .:||.|           ||.||||...|.:..
  Fly    89 -TVRLGE---YDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKL 149

  Fly   298 QVRPACLWQLPELQIP---TVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRG 359
            .:||.||::.|. |:|   |..|||||:.:.:.. :..|:.|:|..:.|..|      ||.|...
  Fly   150 FIRPICLFRDPG-QVPYSSTYEAAGWGKIDLINT-ATVLQTVNLIRLDQSDC------ERSLRTS 206

  Fly   360 IIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFV-VGITSFGKFCAAPNAPGVYTRLYSY 423
            :..||||||....  |||.||||||:...:........| :||.|:|.:..  ..|||||.:.|:
  Fly   207 LSYGQFCAGQWRA--DTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC--RGPGVYTYVPSF 267

  Fly   424 LDWIEKI 430
            .:||..|
  Fly   268 TNWILSI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 87/259 (34%)
Tryp_SPc 186..427 CDD:214473 85/256 (33%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 85/257 (33%)
Tryp_SPc 40..274 CDD:238113 87/259 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.