DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Plau

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_032899.1 Gene:Plau / 18792 MGIID:97611 Length:433 Species:Mus musculus


Alignment Length:370 Identity:100/370 - (27%)
Similarity:156/370 - (42%) Gaps:82/370 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SVSEGLHEGAFCRRSFDGRSGYCILAYQCLHVIREYRVHGTRIDICTHRNNVPVICCPLADKHVL 146
            ::|.||.:..:||...:.:..:|.:.......::|..||.                |.|:.|...
Mouse   112 AISLGLGKHNYCRNPDNQKRPWCYVQIGLRQFVQECMVHD----------------CSLSKKPSS 160

  Fly   147 AQRISATKCQEYNAAARRLHLTDTGRTFSGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGS 211
            :......:|                    |::.:.....||||..|.....|..||: :.:..|.
Mouse   161 SVDQQGFQC--------------------GQKALRPRFKIVGGEFTEVENQPWFAAI-YQKNKGG 204

  Fly   212 KDQDIKWGCGGALVSELYVLTAAHCATSGSKPPD-MVRLGARQLNETSATQQDIKILI--IVLHP 273
            .....|  |||:|:|..:|.:||||.....|..: :|.||  |..|:|....::|..:  ::||.
Mouse   205 SPPSFK--CGGSLISPCWVASAAHCFIQLPKKENYVVYLG--QSKESSYNPGEMKFEVEQLILHE 265

  Fly   274 KYR--SSAYYHDIALLKLT----RRVKFSEQVRPACLWQLPELQIPTVVAA---------GWGR- 322
            .||  |.||::||||||:.    :..:.|..::..|   ||    |....|         |:|: 
Mouse   266 YYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTIC---LP----PRFTDAPFGSDCEITGFGKE 323

  Fly   323 --TEFLGAKSNALRQVDLDVVPQMTCKQ--IYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGG 383
              :::|..|:  |:...:.:|....|.|  .|..|      |.....||.......|:|:|||||
Mouse   324 SESDYLYPKN--LKMSVVKLVSHEQCMQPHYYGSE------INYKMLCAADPEWKTDSCKGDSGG 380

  Fly   384 PIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIE 428
            |   |:........:.||.|:|:.||..|.||||||:..:||||:
Mouse   381 P---LICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLDWIQ 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829 6/45 (13%)
Tryp_SPc 186..430 CDD:238113 86/266 (32%)
Tryp_SPc 186..427 CDD:214473 84/263 (32%)
PlauNP_032899.1 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 35..58
Kringle 71..152 CDD:333799 9/55 (16%)
Connecting peptide 153..179 4/45 (9%)
Tryp_SPc 180..424 CDD:238113 86/266 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.