DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and try-4

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:275 Identity:66/275 - (24%)
Similarity:109/275 - (39%) Gaps:69/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 SKDQDIKWG----------CGGALVSELYVLTAAH------------CATSGSKPPD-------- 245
            ||.::..|.          .||:::|..:::||||            |.....|.|:        
 Worm    53 SKIKNFPWAVSFTVDGVNRLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIK 117

  Fly   246 ------MVRLGA--------RQLNETSATQQDI---KILIIVLHPKYRSSAYY--HDIALLKLTR 291
                  .|..|.        :..|:....:.|:   |:..:::..::.||...  ||.|::::.:
 Worm   118 FLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEK 182

  Fly   292 RVKFSEQVRPACL-----WQLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYR 351
            |:.|||.|||.||     :....|.:|     ||||:.........:.::.:.:  ...||:.: 
 Worm   183 RIHFSENVRPICLPRPNMYYTKSLAVP-----GWGRSYIFNESGPLIHEIPMRI--DRDCKRPW- 239

  Fly   352 KERRLPRGIIEGQFCAGYLP----GGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPN 412
             ..|||.. .:...||..:.    ....||.|||||.:......|. .||::.|||||......|
 Worm   240 -SDRLPAD-ADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYG-RAFLIAITSFGTRGCPSN 301

  Fly   413 APGVYTRLYSYLDWI 427
            ....:||:..||:.|
 Worm   302 MLARFTRVDMYLNLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 66/275 (24%)
Tryp_SPc 186..427 CDD:214473 65/273 (24%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 66/275 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.