DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and try-10

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:247 Identity:64/247 - (25%)
Similarity:105/247 - (42%) Gaps:64/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 CGGALVSELYVLTAAHCATSGSKPPDM-----VRLGARQLNETSATQQDIKILIIVLHPKY--RS 277
            |||.|::...|:|:|||..||.   |.     |.||...||:....:|:.:...:.:..|:  .:
 Worm   104 CGGVLIAPSIVITSAHCVFSGD---DFAVTAKVTLGDVHLNKHDDGEQEFRSHAMAISKKFFNDA 165

  Fly   278 SAYYHDIALLKLTRR--------------------VKFSEQVRPACLWQLPELQIPTVV--AAGW 320
            |....|:|::.|.:|                    |.|.|..      .|.:||:.|.|  .|||
 Worm   166 SEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETA------PLTQLQLETSVCYVAGW 224

  Fly   321 GRTEFLGAK-SNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGP 384
            |:||...|| |:::||    ::..::.::|.:::..:.:.:          .|....|.||||.|
 Worm   225 GKTENKTAKYSDSVRQ----MMVNLSVRRIGKRKYLIAKAV----------TGSSRACMGDSGSP 275

  Fly   385 IHALLPEYNCVAFVVG----ITSFGKFCAA-PNAPGVYTRLYSYL---DWIE 428
            ::..:   |....:||    |.||.|.... |:....:.|.:.|.   ||.|
 Worm   276 VYCFV---NGKRILVGTVAHIGSFSKMSEQDPSNHISFCRDFEYTFVSDWRE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 64/247 (26%)
Tryp_SPc 186..427 CDD:214473 62/244 (25%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 54/211 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.