DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Gzmk

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:255 Identity:78/255 - (30%)
Similarity:118/255 - (46%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCAT---SGSKPPDMV 247
            |:||...:....|.||::.:..         |..|||.|:...:|||||||.:   .|..|  .|
Mouse    26 IIGGREVQPHSRPFMASIQYRS---------KHICGGVLIHPQWVLTAAHCYSWFPRGHSP--TV 79

  Fly   248 RLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQI 312
            .|||..|::....:|..:|...:...:.:|.:..|||.|:||....:.::.|:...|.....|:.
Mouse    80 VLGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNKNVQLLHLGSKNYLRD 144

  Fly   313 PT-VVAAGWGRT--EFLGAKSNALRQVDLDVVPQMTC-KQIYRKERRLPRGIIEGQFCAGYLPGG 373
            .| ....|||.|  :.|.| |:.||:|.:.::.:..| .|.|...:.:   |.:...|||...|.
Mouse   145 GTKCQVTGWGTTKPDLLTA-SDTLREVTVTIISRKRCNSQSYYNHKPV---ITKDMICAGDARGQ 205

  Fly   374 RDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRL-YSYLDWIE-KIA 431
            :|:|:||||||:       .|......:.|.|..|.....||:||.| ..|..||: |:|
Mouse   206 KDSCKGDSGGPL-------ICKGIFHALVSQGYKCGIAKKPGIYTLLTKKYQTWIKSKLA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 76/252 (30%)
Tryp_SPc 186..427 CDD:214473 74/248 (30%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 74/248 (30%)
Tryp_SPc 26..256 CDD:238113 76/251 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.