DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG43742

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:234 Identity:74/234 - (31%)
Similarity:106/234 - (45%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 CGGALVSELYVLTAAHCATSGSKPPDM----VRLGARQLNETSATQQDIKILI-----IVLHPKY 275
            |||:|:.:.||||||||..      |:    |.||.   |..|......|.::     ::|||.:
  Fly    58 CGGSLIHKQYVLTAAHCVR------DLDEVTVHLGE---NNRSCPIPVCKHVLRLNAKVILHPNF 113

  Fly   276 RSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPT-----VVAAGWGRTEFLGAKSNALRQ 335
            ..:.:.:|||||:|.|.|.|...:||.|:  :.:..:.:     ..|.|||:||. |..|:.|..
  Fly   114 HGNIFLNDIALLRLEREVIFEAHIRPICI--ILDEDVTSNNQNNFTAYGWGKTEH-GNISDVLSF 175

  Fly   336 VDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCV----- 395
            :||..:|:..|.|..            ...|||...|  |||:.|||||:..     |.|     
  Fly   176 IDLVRLPKSMCYQNI------------NTICAGSTSG--DTCESDSGGPLIG-----NFVHRGKS 221

  Fly   396 -AFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKIAFK 433
             ..:.||||:|. .......||||.:.:|..||..:..:
  Fly   222 RDILFGITSYGD-AECSGLFGVYTDVNAYKSWIASVVLE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 74/229 (32%)
Tryp_SPc 186..427 CDD:214473 72/226 (32%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 72/226 (32%)
Tryp_SPc 35..256 CDD:238113 74/229 (32%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.