DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and Egfbp2

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:285 Identity:75/285 - (26%)
Similarity:123/285 - (43%) Gaps:60/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 TFSGKQCVPSVPL---IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAA 234
            :..|....|  ||   :|||...:....|...|:.:      :.:.|   |||.|:...:|||||
Mouse    11 SLGGIDAAP--PLQSRVVGGFNCKKNSQPWQVAVYY------QKEHI---CGGVLLDRNWVLTAA 64

  Fly   235 HCATSGSKPPDMVRLGARQLNETSATQQDIKILIIVLHPKYRSSA-----------YYHDIALLK 288
            ||.....:    |.||..:|.:...:.|...:.....||.:..|.           :.:|:.||:
Mouse    65 HCYVDQYE----VWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSNDLMLLR 125

  Fly   289 LTRRVKFSEQVRPACLWQLPELQIPT--------VVAAGWGR-TEFLGAKSNALRQVDLDVVPQM 344
            |::....::.|:|        :.:||        .:|:|||. |.....|.:.|:.|.:.::|..
Mouse   126 LSKPADITDVVKP--------IALPTKEPKPGSKCLASGWGSITPTRWQKPDDLQCVFITLLPNE 182

  Fly   345 TCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKF-C 408
            .|.::|.::      :.:...|||.:.||:|||:.|||||:       .|...:.|.||:|.. |
Mouse   183 NCAKVYLQK------VTDVMLCAGEMGGGKDTCRDDSGGPL-------ICDGILQGTTSYGPVPC 234

  Fly   409 AAPNAPGVYTRLYSYLDWIEKIAFK 433
            ..|..|.:||.|..:..||:....|
Mouse   235 GKPGVPAIYTNLIKFNSWIKDTMMK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 70/264 (27%)
Tryp_SPc 186..427 CDD:214473 68/261 (26%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 68/262 (26%)
Tryp_SPc 25..256 CDD:238113 70/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.