DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and LOC1281744

DIOPT Version :10

Sequence 1:NP_524338.2 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_061519534.1 Gene:LOC1281744 / 1281744 VectorBaseID:AGAMI1_004580 Length:722 Species:Anopheles gambiae


Alignment Length:100 Identity:19/100 - (19%)
Similarity:38/100 - (38%) Gaps:14/100 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 VTILPKLDSDRGEIEGRIDHHQ-------FEKILDE-----DLAAGKKPLILIGVVGTTIMGQND 296
            :::.|.|.....::.|.:.:||       ||..:.|     .|..||:....:.......:|...
Mosquito     1 MSLTPFLRLPLTDLTGCLINHQTYDKCGKFEMKMMECFEAYGLERGKRECADLISDFQECVGMQK 65

  Fly   297 MISKILEIREKKAKFWLHITGQAIAALTFREPNNI 331
            .:.:...:|.::.|.||  .|:......|.:|..:
Mosquito    66 QLMRFHAMRNERYKQWL--KGERKGQEFFADPPRV 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_524338.2 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 19/99 (19%)
LOC1281744XP_061519534.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.