DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CG43110

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:253 Identity:84/253 - (33%)
Similarity:124/253 - (49%) Gaps:33/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 VPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMV 247
            ||.|:.|:........:||.:..|         ....|||.::.|.:|||.|||.::.:.   .|
  Fly    33 VPKIISGSNASQQSAQYMAGIFNT---------THLLCGGTIIHEDFVLTVAHCKSTQTL---FV 85

  Fly   248 RLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPEL-- 310
            ||||..:|..:   ..|:::..:.||:|.:|.|.:||||:||.|.|.|:..::|.|:.....|  
  Fly    86 RLGAYNINHPT---DQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGK 147

  Fly   311 QIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRD 375
            ||....|.|||||. ...:|:.|:::.::....|.| .:|......|:     |.||....|  |
  Fly   148 QIRYYNAFGWGRTR-NAEQSDILQRIFVNRTNPMIC-HLYLGMSPDPK-----QICATTDQG--D 203

  Fly   376 TCQGDSGGPIHALLPEYNCVAF--VVGITSFG-KFCAAPNAPGVYTRLYSYLDWIEKI 430
            ||.||||||:.:.: .|....|  ..||||:| :.|   |..|:||.:..|..||..|
  Fly   204 TCAGDSGGPLISKI-TYQGKNFDTQFGITSYGTREC---NGVGLYTDVSQYSGWIANI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 81/248 (33%)
Tryp_SPc 186..427 CDD:214473 79/245 (32%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 79/246 (32%)
Tryp_SPc 36..257 CDD:238113 81/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.