DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and CMA1

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001827.1 Gene:CMA1 / 1215 HGNCID:2097 Length:247 Species:Homo sapiens


Alignment Length:250 Identity:83/250 - (33%)
Similarity:116/250 - (46%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSG-SKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRL 249
            |:|||..:....|:||.|.....:| ||      .|||.|:...:||||||||....    .|.|
Human    22 IIGGTECKPHSRPYMAYLEIVTSNGPSK------FCGGFLIRRNFVLTAAHCAGRSI----TVTL 76

  Fly   250 GARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVR----PACLWQLPEL 310
            ||..:.|...|.|.::::....||||.:|..:|||.||||..:...:..|.    |:....:|..
Human    77 GAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPG 141

  Fly   311 QIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRD 375
            ::..|  ||||||..|...|:.|::|.|.::....|......:..|       |.|.|.....:.
Human   142 RMCRV--AGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNL-------QLCVGNPRKTKS 197

  Fly   376 TCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKI 430
            ..:||||||:       .|.....||.|:|:..|.|  |.|:||:..|..||.:|
Human   198 AFKGDSGGPL-------LCAGVAQGIVSYGRSDAKP--PAVFTRISHYRPWINQI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 82/248 (33%)
Tryp_SPc 186..427 CDD:214473 80/245 (33%)
CMA1NP_001827.1 Tryp_SPc 22..243 CDD:238113 82/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6142
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.