DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and LOC101886682

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_005170582.2 Gene:LOC101886682 / 101886682 -ID:- Length:252 Species:Danio rerio


Alignment Length:254 Identity:85/254 - (33%)
Similarity:119/254 - (46%) Gaps:41/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRL- 249
            |..||..:....|:|.:|      ....|.|   |||:|:|:.:|||||||...    .|::.: 
Zfish    27 IEDGTEAKPHSRPYMVSL------QINSQHI---CGGSLISKEFVLTAAHCWDK----DDVLTVV 78

  Fly   250 -GARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLP----E 309
             ||..|.: .|.....|:...:.||.|.|....:||.||||..:|:.|..|.   |..||    :
Zfish    79 TGAHDLRK-KAIYNTFKVTSYIPHPDYNSYTLENDIMLLKLKTKVRLSNSVG---LISLPRNGED 139

  Fly   310 LQIPTVVA-AGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGG 373
            |:..|:.: |||||....|||::.||:.:..:|....|      |||.....:..:....|..||
Zfish   140 LKADTLCSIAGWGRLWRKGAKTDRLREAETVIVNDAEC------ERRWESDYVASKMICAYGHGG 198

  Fly   374 RDTCQGDSGGPIHALLPEYNCVAFVVGITSFGK--FCAAPNAPGVYTRLYSYLDWIEKI 430
              ||.||||||:       .|....||||:|..  .|.:...|.|:.|:.:||.||:.|
Zfish   199 --TCSGDSGGPL-------VCNNTAVGITAFSDRYLCKSRLFPDVFARISAYLPWIQNI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 84/252 (33%)
Tryp_SPc 186..427 CDD:214473 82/249 (33%)
LOC101886682XP_005170582.2 Tryp_SPc 27..248 CDD:238113 84/252 (33%)
Tryp_SPc 27..245 CDD:214473 82/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.