DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and XB5962685

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_002941155.3 Gene:XB5962685 / 100496550 XenbaseID:XB-GENE-5962686 Length:251 Species:Xenopus tropicalis


Alignment Length:266 Identity:76/266 - (28%)
Similarity:123/266 - (46%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 VPSVPLIVGGTPTRHGL--------FPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHC 236
            :|::.:::..||...|:        .||.........:||.      .|||.|:.:.:|||||.|
 Frog     5 IPALFVLLLNTPICAGMGITGGKEAIPHARRYMALVRTGSN------LCGGTLIKDNWVLTAATC 63

  Fly   237 ATSGSKPPDMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRP 301
            ....:...|   ||...:...:..:|..|:...|.|.|:...:|.:::.||:|:.:..||..|. 
 Frog    64 KVDRTTTVD---LGVHSIKTMNKLRQQFKVARWVPHQKFDRRSYVNNLQLLQLSSKANFSYAVN- 124

  Fly   302 ACLWQLP----ELQIPTVV-AAGWGRTEFLG-AKSNALRQVDLDVVPQMTCKQIYRKERRLPRGI 360
              :..||    :::..||. .||||.|.:.| .:|:.|.:|.|.|:.:|.|...::.:.::.:.:
 Frog   125 --ILLLPTKYKDIKPGTVCETAGWGITAYNGKQQSDKLMEVSLTVLDRMQCNNQWKSKIKITKDM 187

  Fly   361 IEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGK-FCAAPNAPGVYTRLYS-Y 423
            :    |... .|.|..|.||.|||:       .|...:.|:.|||. .|...|...|||||.| |
 Frog   188 M----CTRD-KGKRGFCNGDGGGPL-------ICNRILTGVISFGPLICGMENGANVYTRLTSNY 240

  Fly   424 LDWIEK 429
            :.||:|
 Frog   241 IKWIKK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 75/260 (29%)
Tryp_SPc 186..427 CDD:214473 72/256 (28%)
XB5962685XP_002941155.3 Tryp_SPc 23..246 CDD:238113 71/246 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.