DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and gzma

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:276 Identity:89/276 - (32%)
Similarity:122/276 - (44%) Gaps:61/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATS 239
            :|..|:.    |:.|........|:||.:....||          |||.|:.:.:|||||||..:
 Frog    28 NGNICMD----IIDGREAASHSRPYMAYIYSRTGS----------CGGTLIKQNWVLTAAHCVVN 78

  Fly   240 GSKPPDMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACL 304
            .|:    |.|||.::......||...:...:.||.:......|||.||::....|.::.|     
 Frog    79 NSE----VILGAHKVKSRENEQQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFV----- 134

  Fly   305 WQLPELQIPTV----------VAAGWGRTEFLG-AKSNALRQVDLDVVPQMTCKQIYRKERRLPR 358
               ..|::||.          ..||||.|:..| ..|:.||:|::.||.:.||.:||:|   ...
 Frog   135 ---SVLKLPTTDMDVKPGSSCSTAGWGVTKPNGKTPSDVLREVNVTVVDRGTCNKIYKK---FKT 193

  Fly   359 GIIEGQFCAG--------YLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNAPG 415
            .|.....|||        |     |.||||||||:       .|.....||.||||.|..|..||
 Frog   194 EISTNMLCAGAPKKSDKKY-----DACQGDSGGPL-------ICGKEFSGIVSFGKKCGDPKYPG 246

  Fly   416 VYTRLYS-YLDWIEKI 430
            :||||.: ||.||..:
 Frog   247 IYTRLTARYLQWIRDV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 87/263 (33%)
Tryp_SPc 186..427 CDD:214473 85/260 (33%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 87/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.