DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snk and tmprss12

DIOPT Version :9

Sequence 1:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster
Sequence 2:XP_031751504.1 Gene:tmprss12 / 100127698 XenbaseID:XB-GENE-964846 Length:324 Species:Xenopus tropicalis


Alignment Length:253 Identity:85/253 - (33%)
Similarity:123/253 - (48%) Gaps:27/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 IVGGTPTRHGLFPHMAALGWTQG-SGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVR- 248
            ||||.....|.:|...:|.:.:. ||...:     |||:|:...:||:||||..: ::.|:..| 
 Frog    41 IVGGRNALPGAWPWQVSLQYFRTLSGYSHR-----CGGSLIQNNWVLSAAHCFRA-NRNPEYWRA 99

  Fly   249 -LGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQI 312
             ||...:....:.....||..|::|..|...|..:|||||.|...|.:|:.:.|.|   |..:.:
 Frog   100 VLGLHNIFMEGSPVVKAKIKQIIIHASYDHIAITNDIALLLLHDFVTYSDYIHPVC---LGSVTV 161

  Fly   313 PTVVAA----GWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAGYLPGG 373
            |..:.|    |||.|:..|:.|..|::..:..:|...|    .........|.:...|||...|.
 Frog   162 PDSLTACFITGWGVTKEKGSISVILQEALVQTIPYSEC----NSSSSYNGFITQSMICAGDNSGA 222

  Fly   374 RDTCQGDSGGPIHALLPEYNCVA---FVVGITSFGKFCAAPNAPGVYTRLYSYLDWIE 428
            .|:||||||||...    ||...   :.:||||||..|..||.|||||::.||:.||:
 Frog   223 VDSCQGDSGGPFVC----YNTERMRFYQMGITSFGYGCGKPNFPGVYTKVESYVSWIK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 85/253 (34%)
Tryp_SPc 186..427 CDD:214473 83/250 (33%)
tmprss12XP_031751504.1 Tryp_SPc 41..278 CDD:238113 85/253 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.